PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G08350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 137aa    MW: 15565 Da    PI: 10.5803
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G08350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.82.7e-172255134
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                     Cs+C+t+kT+ WR+gp g+k+LCnaCG++y +kg
  OPUNC07G08350.1 22 CSHCQTSKTSVWRNGPFGPKSLCNACGIRYHRKG 55
                     ******************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.23E-141456No hitNo description
SMARTSM004011.5E-111668IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.21671IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.0E-151773IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.01E-122156No hitNo description
PfamPF003202.0E-152255IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MEPESSLRKV VFPVDLNNPR ICSHCQTSKT SVWRNGPFGP KSLCNACGIR YHRKGIDALK  60
LEGKRGKDKK RKTSRNEVSL RRGLRKKNMS AKEVDFGVRM MMEGCQSEPM LTQGQQYEDD  120
VKKAAIQLMY LSRAANS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043441e-127AP004344.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0639B07.
GenBankAP0062661e-127AP006266.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0003K21.
GenBankAP0149631e-127AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646409.13e-91PREDICTED: GATA transcription factor 15-like
TrEMBLA0A0E0LIY31e-100A0A0E0LIY3_ORYPU; Uncharacterized protein
STRINGBGIOSGA024531-PA7e-90(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18253810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06740.16e-16GATA transcription factor 15